SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002254 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002254
Domain Number 1 Region: 7-409
Classification Level Classification E-value
Superfamily Sema domain 1.44e-105
Family Sema domain 0.00000324
Further Details:      
 
Domain Number 2 Region: 412-453
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000249
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 474-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000546
Family I set domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002254   Gene: ENSMGAG00000002642   Transcript: ENSMGAT00000002929
Sequence length 583
Comment pep:novel chromosome:UMD2:12:1830638:1839980:1 gene:ENSMGAG00000002642 transcript:ENSMGAT00000002929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGEREYTFPRNEKYPVFYHETNSSSIYVGGEGVLYYYNFATSETYPVREDNKNFITLIAK
HGSEMLVCGTGACNPTCWHLTEKKKDAPQDGRGLAPFTPDTNSLVIVDYPNIYSTIKKSQ
QNGKIPRFRRVKGDGELYTSDTVMQNPQFVKATTLKHEDSYQDKIYYFFREDNPDKSPEA
PRNISRVAQLCKEDKGGTSSLSASKWTTFLKASLICVDPATKGNFNWLQDVFFVNASDWR
DSKVYGLFTNTWGSSAVCVYSFGDIDNVFRTSKLKGYDGPDPEIKPGQCVPFRQHTPSET
FKIADSHPEVENRVEPLAPTRSPLFHNKHRYQKIGVHEVSASDGHQYTVLYLATDRGSIH
KVVELPGGVHNIMELQVFSKKDPIQSMILDHERAMLYVGSSRKVVEIAMDMCGVYHNNCQ
SCLLARDPYCGWADGRCQSIYRNRTREVRQNLNLEPWQGKCQNGEDSYQNVTVVPVVPFS
RYYLNCPVESHYATYNWYHNNTLIKTCNNTHPQPDCFYFIQNVSHTHYGRYICVSEEDGF
RQALVKEHLVNQLRFMSQKGQATMTLASWLQLLLMVVLVELFH
Download sequence
Identical sequences G1MUM7
ENSMGAP00000002254 ENSMGAP00000002254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]