SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002465 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002465
Domain Number 1 Region: 6-333
Classification Level Classification E-value
Superfamily Sema domain 6.93e-107
Family Sema domain 0.0000000128
Further Details:      
 
Domain Number 2 Region: 392-473
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000356
Family I set domains 0.028
Further Details:      
 
Domain Number 3 Region: 329-380
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000785
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002465   Gene: ENSMGAG00000002789   Transcript: ENSMGAT00000003144
Sequence length 548
Comment pep:novel chromosome:UMD2:14:2712644:2715649:1 gene:ENSMGAG00000002789 transcript:ENSMGAT00000003144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAPCPHCPADGQLYSGTSSDFMGSSAAFFRTEVGGAERGYIRTEQHQDHWLHEPTFIGA
FAIPDTHNPHDDKVYIFFRETALDGGQWERRHIHARVARVCKNDVGGKRGLINRWSTFLK
ARLLCSIPGPQGTQTHFDQLEDVFLLHTRDPQNPLVFGLFTASSAVFSGSAVCVYSMAAV
RAAFSGPFIHPSRDTCPSETYDPLLRSTKDFPDEVISFVRAHQLMWEPIHPLGRRPVLLR
ANVPYRLRQLLVHRLEAEGRHYDVLFLGTDDGKVLKVGLPGEAGAEAVSLEEISVTEVPS
PILDMKLSPKRQELLVSSTQGLLQLSLSRCELYGQTCMDCCLARDPYCTWDGSACTSLLL
TEKRRAWCQDVLKADVLSQCQDTAEGMAAVEQPVFGVEKNSTFLECQARSPQTAVRWLAR
RGEGLGLSEVRSGRRVVVLEQGLLIRQLGWEDAGTYECQAVERSFSWPLIRYSLRIIRHE
ATELPHRRGKGAESSWTDPRVLGAPGSGSLDAYCTALRLRERQRQKAWQQKWQHRAPESK
SSRVRRQP
Download sequence
Identical sequences G1MV34
ENSMGAP00000002465 ENSMGAP00000002465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]