SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002474 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002474
Domain Number 1 Region: 40-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000021
Family Ubiquitin-related 0.00025
Further Details:      
 
Domain Number 2 Region: 337-380
Classification Level Classification E-value
Superfamily UBA-like 0.000000000065
Family UBA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002474   Gene: ENSMGAG00000002826   Transcript: ENSMGAT00000003153
Sequence length 384
Comment pep:novel chromosome:UMD2:12:1801229:1805696:1 gene:ENSMGAG00000002826 transcript:ENSMGAT00000003153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEMAVSEWHIAVKLADQPLAPKSILRLPETELGECPLGGCSISHLKQLITGKLQESVRTP
SSSIDLIYCGRKLRDDQTLDFYGIQSGSTVHVLRKSWPEPDQKPEPVDKVAAVREFRVLH
TALHSSPAYRDAVFKMLGNKESLDQIIVATPGLSSDPVALGVLQDKDLFSVFADPNMLDT
LIPAHPALVNAIVLVLHSVAGSTPLPAPETSSRGMSSGSYRDMPGGFLFEGLSDDEDDFH
QQSTRSTPSSSTSGSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGH
SSGTSPMSSSVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIHDDELS
LRALQATGGDIQAALELIFAGGAP
Download sequence
Identical sequences G1MV42
ENSMGAP00000002474 ENSMGAP00000002474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]