SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002503 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002503
Domain Number 1 Region: 130-326
Classification Level Classification E-value
Superfamily E set domains 2.33e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000339
Further Details:      
 
Domain Number 2 Region: 24-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-20
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002503   Gene: ENSMGAG00000002877   Transcript: ENSMGAT00000003182
Sequence length 337
Comment pep:novel chromosome:UMD2:26:4667921:4669120:-1 gene:ENSMGAG00000002877 transcript:ENSMGAT00000003182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKQQRQRYVTKVGKCQVNLGNIQEKKRFLSDIFTTIVDLKYRWFLFVFMMCYIVTWVVFG
TIYFFDAWIRDDINHIGDPEWKACIENVDNFISALLFSVESQRTIGYGSRIVTANCVEGV
ILLMVQSIIGSMIDALMVGCMFVKISRPKKRAQTLIFSKNCVISHRDEKLCLMFRIGDLR
ESHMVDAKIRAKLIKSRQTKEGEFIPLEQSELNLGYDTGEDRLFLVEPQIICHVINQHSP
FWDLSAESLKREQFEIIIILEGIVEATGMTCQARTSYTEDEILWGYRFEPCMSLEKGAFR
VDYSRFELTFEVQTPAASAREMQEMAELERRDRSTPS
Download sequence
Identical sequences G1MV64
ENSMGAP00000002503 ENSMGAP00000002503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]