SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002518 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002518
Domain Number 1 Region: 13-156
Classification Level Classification E-value
Superfamily Sema domain 1.44e-26
Family Sema domain 0.00096
Further Details:      
 
Domain Number 2 Region: 152-200
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000872
Family Plexin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002518   Gene: ENSMGAG00000002890   Transcript: ENSMGAT00000003198
Sequence length 501
Comment pep:novel chromosome:UMD2:30:2104405:2108522:-1 gene:ENSMGAG00000002890 transcript:ENSMGAT00000003198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFPRAEITGVHLDSCTSSSTFPDEILTFVKTHPLMDEAVPSLGNAPWIVRTMSRYQLRKI
VVDNAAGPWGNHTVVFLGSSKGTILKFLIHPRPACSRAGGDRSWGHTELCPIPRCGRDTE
DERRLLGLELDKAAGSLLLAFPPCVARVPVARCQQHSGCMKSCLGSRDPYCGWTPEGSCV
FLEPSPRTAFEQDISGGSTSHLGECEGLVTESFVDEPDGLVSVNLLVISSVAAFVIGAVI
SGFSVCWFIGHRDRKELARRKDKETILAHSESVVSVSRLGERRARGGQPGALLAPLMPNG
WPKELGKANQHDLDSGVLPTPEQTPLQQKRCPGALQNCTWEQNHNIINAALRDPGASGTR
LHAGAGRSCPAACLSPGLRHPGGSGAGADSATPRGADFGGTPRPSPDRRRVVSAPGGEGG
DFVEGPPWHPEQLNFNANNGTQRPGAHLKRNHTFNSGEAPAGGYGQHGTAPRAPGAGPPR
ALTDLHHLLRYGMERTPSAVP
Download sequence
Identical sequences G1MV77
ENSMGAP00000002518 ENSMGAP00000002518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]