SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002619 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002619
Domain Number 1 Region: 251-383
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-34
Family DEP domain 0.0000091
Further Details:      
 
Domain Number 2 Region: 77-188
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-23
Family PDZ domain 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002619   Gene: ENSMGAG00000002918   Transcript: ENSMGAT00000003300
Sequence length 551
Comment pep:novel chromosome:UMD2:23:2372795:2387422:1 gene:ENSMGAG00000002918 transcript:ENSMGAT00000003300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RINGHPKLDRHREHPPGYDSSSTMMSSELESSSFIDSDDDDNTSRLSSSTEQSTSSRLIR
KHKRRRRKQRMRQIDRSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNDRGDGG
IYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAK
CWDPTPRSYFTIPRAEPVRPIDPAAWISHTTAMTGAYPRYGMSPSMSITTSTSSSLTSSI
PDSEKLEESPLTVKSDMATIVKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHV
EGFKDRREARKYASSMLKHGYLRHTVNKITFSEQCYYVFGDLCGNMAALNLNNGSSGASD
QDTLAPLPHPAAPWPLGQGYPYQYPLPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGS
NRSNSENSRRALGREKDRKSAGSGSESEHTACSGGTGTARRERPVSQLSHRSHVSATHSE
RSHHSHHSYGPPGVPPLYNLPKLGSKVYGTSGPPGGPPVRELSSVPPELTGSRQSFQKAM
GNPCEFFVDIM
Download sequence
Identical sequences G1MVF0
ENSMGAP00000002619 ENSMGAP00000002619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]