SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002622 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002622
Domain Number 1 Region: 13-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-64
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 315-353
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000531
Family Ubiquitin-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002622   Gene: ENSMGAG00000002921   Transcript: ENSMGAT00000003303
Sequence length 752
Comment pep:novel chromosome:UMD2:24:2894152:2905276:1 gene:ENSMGAG00000002921 transcript:ENSMGAT00000003303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPPALQAQTCGPWEMKERLGTGGFGNVIRWHNKETGEQVAKQCRQELSPRNRDRWALE
IQIMKRLNHPNVVAARDVPEGMQKLAPNDLPLLAMEYCQGGDLRKYLNQLENCCGLREEA
ILILLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTS
FVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHTKVRQKSEL
DIVVSEDLSGEVKFSSSLPCPNNLNSVLAGKLEKWLQLMLMWHPRQRGTDPVYGPNGCFK
ALDDILNLKLLHVLNMVTGTVHTYPVTEEETLQTVKARIQSDTGIPEQDQELLQEAGLAL
FTQKHSADSKVNDAAAADTDLLFLFDNQKVAYEAQVALRPHPESVDYILQDPKKNLHFFQ
LRKVWGQIWHTIRMLKEDCNRLQQGQRAAMMNLLRYNSTLSKMKNSMASLSQQLKAKLDF
FKTSIQIDLEKYKEQIEFGITSEKLLFAWKEMEQAVELCGREDDVDQLVKRMMALQTDIV
DLQRSPLGRKQGGTLEDLEEQARELYRRLREKPRDQRTSGDSQEIVRLLLQAIQTFEKKV
RVIYAQLSKTVVCKQKALELFPKVEKVMNLMNEDEETVIRLQEKRQKELWNLLKIACSKV
RGPVSGSPESMNMSRLNSPGQLLLQVPSGTYALPESVRKSEELLLESQKLCSQLENVMHD
TMKDQEQSFMALDWSWLQLQAEERSNPEQTHM
Download sequence
Identical sequences G1MVF3
ENSMGAP00000002622 ENSMGAP00000002622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]