SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003501 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003501
Domain Number 1 Region: 205-322
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-25
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 2 Region: 566-733
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-24
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003501   Gene: ENSMGAG00000003752   Transcript: ENSMGAT00000004205
Sequence length 869
Comment pep:novel chromosome:UMD2:19:5017422:5090269:1 gene:ENSMGAG00000003752 transcript:ENSMGAT00000004205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGQKRGGFKKFKFFKFKGFESLSNIPRSFTLRRVSPESLGMGLPPPQGFLEESFGSTQ
DDLNTMPKSPGAYARSSDMYSHMGTMPRLSLGKAVSGKAEQEKEEALPSGSPGVEKASTD
QETPGNSPCPGMEAPSPSLAPSPSAASEAETTDGDFREKGQEHPSHSSLDSHHDGLESGS
EYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSESLVQRNGDFL
IRDSLTSLGDYVLTCRWRNEPLHFKINKVTVKSSDSRTRVQYLFEQESFDNVPALVRFYV
GNRKAISEQSGAIVYCPINRTFPLRYLEASYGLANGKHGGSHSPASQKGGHIKRRSITMT
DGLTADKITRAEGCSTSVSLPHHRDIIRNCAVSVDQIQDLHSPMSPISENPTSPAYSTVT
RLKPHTCQAAGITPASPVIRRSSEPQLCPGSSNKPLPDPAHSTHSTPCHGYARASPSPSV
NSYSDPDTGHYCQLHPTSPISRERPAHDTKPAKSYVERLKVEEGQRGTVENGSGEAEAGQ
RLKGERDFVGFVPPTVETCSSFNPAAFQSLLIPLENKPLEMAVLKKVKELLADVDAKTLA
KHITKVDCLVARILGVTAEMQRLMGVSSGMELLTLPHGHQLRLDLLERFHTMSIMIAVDI
LGCTGSTEERAALLHKTIQLAAELKSTMGNMFSFAAVMNALEMAQISRLEQTWMVLRQRH
TEGAILYEKKLKPFLKSLNEGKEGPPLTNTTFPHVMPLVTLLERDDALMDSPEPWEATDS
GVEVVMAHLEAARMVAHHGGLYHTNAEVKLQGFQGRAELLEIFSTEFQLRLLWGSRGAES
SQAERYEKFDKVLTALSHKLEPAVRFSEL
Download sequence
Identical sequences G1MXD8
ENSMGAP00000003501 ENSMGAP00000003501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]