SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003557 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003557
Domain Number 1 Region: 2-415
Classification Level Classification E-value
Superfamily Sema domain 2.09e-149
Family Sema domain 0.000000000271
Further Details:      
 
Domain Number 2 Region: 472-558
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000131
Family I set domains 0.087
Further Details:      
 
Domain Number 3 Region: 411-451
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000488
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003557   Gene: ENSMGAG00000003588   Transcript: ENSMGAT00000004261
Sequence length 659
Comment pep:novel chromosome:UMD2:14:3101205:3104828:-1 gene:ENSMGAG00000003588 transcript:ENSMGAT00000004261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQTDCANYVRLLQPYNRTHLLACGTGACHPVCTFIYVGHRGETQHAFNLDPGSMESGRGR
CPHEPDRAFASTIIGGELYAGLTADFLGRDPGIFRSTGTRAALRTEVDQRLLNDPKFVAA
YMIPDNDDQDDDKAYFFFTEKVVEADSKEHTIVSRVARVCVNDAGGQRVLVNKWSTFNKA
RLVCSVPGPGGIDTHFDELEDVFLLRTKDGKNPEIYALFSTVSHVFQGSAVCVYRMADIR
EVFNGPFAHRDSPLHQWGAYEGRVPYPRPGVCPSKTTNQPQRPYRSTKELPDEVLHFARA
HPLMYRPVRPRHHRPLLVKTDLQHGLRQLVVDRVDTEDGQHDVLFLGTDAGSVLKVVVLQ
KQSSAVTEEVVLEELQVFKVPVPITQMEISVKRQKLYVGASLGVAQVRLHQCKSYGTACA
ECCLARDPYCAWDGTACTRYQPSGKRRYVRHTSSVHQCLDQNLTVDDLEHVEEKVLYGME
HNSTFLECVPRSPQASVQWFVQRPPDEQRDEVKTDERVLQTEQGLLFRQLHRRDAGIYYC
KTLEHGFTQTVAKTALEVLGGEQLARATPRQREDRHPLCPEPWLAAPAPKTWYKDILHLA
SSADRQRVEEQCLRLWCGHRKGKMAKGKHALAGMDVGKKGRVAKPQGERIRVPRQAAAT
Download sequence
Identical sequences G1MXI6
ENSMGAP00000003557 ENSMGAP00000003557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]