SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003727 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003727
Domain Number 1 Region: 199-509
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.39e-117
Family Transglutaminase core 0.000000000124
Further Details:      
 
Domain Number 2 Region: 16-197
Classification Level Classification E-value
Superfamily E set domains 8.05e-55
Family Transglutaminase N-terminal domain 0.000000627
Further Details:      
 
Domain Number 3 Region: 525-635
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.26e-28
Family Transglutaminase, two C-terminal domains 0.0000211
Further Details:      
 
Domain Number 4 Region: 637-734
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-27
Family Transglutaminase, two C-terminal domains 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003727   Gene: ENSMGAG00000003939   Transcript: ENSMGAT00000004434
Sequence length 736
Comment pep:novel chromosome:UMD2:3:12317681:12373088:1 gene:ENSMGAG00000003939 transcript:ENSMGAT00000004434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEPTSANREKKQPPVNGRRALPSNNSNAEENDVPEMDAFGLIPRGFNPKDYLRVLDIHM
FKEPNEINKQQHHTDKYYNPKLIVRRGQPFQIQIDFSRPYEPEKDQIWLEYLIGRHPQPN
KGTYIPILIGDVLKPGEWGAKITHKENSSIRLSIMSSATCIIGKFRLYVAIRTPYGIIRT
HRNSATDTYILFNPWCQLDAVYLDDEKEREEYVLNDVGIVFHGDINEVKLRSWSYGQFEE
NILDACLFLMDKAELELSGRGNPIKICRVASAMINSKDDNGVLAGSWDNLYAYGVPPSAW
TGSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLQLDF
FLDDEGQVDNRLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQAVDGTPQETSDGMYRCGPA
SVQAIKHGHVCFQFDAPFVYAEVNSDVIYSRMGKNGSQVIEKIDTTHIGKLIVTKGVGSD
DMVDITENYKFQEGSAEERLALETAVMYGVKKQTTQPSTYQPQKDVEIDLQVQKAVLGSD
FKVTIIFRNKSRNSYTATTYLSGNIVFYTGVTKNEFKKHSFSAKLDPLSSSAFDVMITSA
EYLSDLLDQASFHFFVTARINETGKVLAMQKAMVLEIPTLKIKTKGEMVVDREMSVVVEF
TNPLKQTLENVTLRLEGPGVLRTVKKEFRQIPAMSTLIWEVKCIPKRPGLRKLIASLNCD
ALRHVYGELNIQIQKP
Download sequence
Identical sequences G1MXW0
ENSMGAP00000003727 ENSMGAP00000003727 XP_010706698.1.16129 XP_010706699.1.16129 XP_010706701.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]