SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003784 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003784
Domain Number 1 Region: 124-239
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-22
Family Synaptotagmin-like (S variant) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003784   Gene: ENSMGAG00000004020   Transcript: ENSMGAT00000004492
Sequence length 269
Comment pep:novel chromosome:UMD2:22:5585920:5604022:1 gene:ENSMGAG00000004020 transcript:ENSMGAT00000004492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLREEAQLCLSALARAVSLYFSAGKIGEDESYGDGRRLKGAIQRSTETGLAVEMPSRTVR
QASHESIEDSMNSYGSEGNLNFSGVHLASAGQFSDFLGSMGPAQFVGRQTLATTSMGDVE
IGLQERNGQLEVDIIQARGLTPKPGSKTLPAAYIKAYLLENGVCIAKKKTKVARKSLDPL
YNQVLLFPESPQGKVLQVIVWGNYGRMERKHFMGVARVLLEELDLSTLAIGWYKLFPTSS
MVDPTTGPLLRQSSQLSLESTVGPCCDRS
Download sequence
Identical sequences G1MY02
ENSMGAP00000003784 ENSMGAP00000003784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]