SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003788 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003788
Domain Number 1 Region: 401-576
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.000000384
Further Details:      
 
Domain Number 2 Region: 5-295
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-34
Family BAR domain 0.018
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-17
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003788   Gene: ENSMGAG00000003991   Transcript: ENSMGAT00000004496
Sequence length 582
Comment pep:novel chromosome:UMD2:4:12374846:12468153:1 gene:ENSMGAG00000003991 transcript:ENSMGAT00000004496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQPLEFSDCYLDSPWFRERVRAHEAELEKTNKFIKDLLKDGKNLIAATKNLSAAQRKF
AHSLRDFKFEFIGDAETDDERYIVVDASLHEFSNFLKNLEEQREILSLNLESRVRDNSYF
SLKNLHWLKKKKKSAVFWQELKQHGELTVIHMSEHSKYWDKHLNSKSCLQQDQSQHHFIS
CNALYEIEALLADQRKRKQGLAALLGLFRALYFFFFLGNELFKNLDIFQMKLKSFLHQTR
NRFEGTRSEVEELMNKIRRNPQEHKRANHNTMEGYLYVQEKRPAPFGSSWVKHYCTYRKE
TKKFTMIPFEHRSGGKAGDGELFILTYCTKRNVDTIDRRFCFDLESSDRPGAPVTMQAFS
EEDRKLWMEALDGKEALFINLNKANAKQEGSAQLDKIGFTLIKKCISAVETRGINDQGLY
RVVGVSSKVQRLLSLLMDAKTCNEVDLENSVDWEVKTITSAMKQYLRSLPEPLMTYELHG
EFIIPAKSGSPESRVNAVHFLVHKLPEKNKEMLDILVKHLESVSKHAKRNLMTVANLGVV
FGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKVSFDKSP
Download sequence
Identical sequences G1MY05
ENSMGAP00000003788 ENSMGAP00000003788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]