SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003915 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003915
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily PX domain 0.0000000000703
Family PX domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000003915
Domain Number - Region: 31-133
Classification Level Classification E-value
Superfamily YebC-like 0.0192
Family YebC-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003915   Gene: ENSMGAG00000004148   Transcript: ENSMGAT00000004625
Sequence length 146
Comment pep:novel chromosome:UMD2:3:13375926:13385724:1 gene:ENSMGAG00000004148 transcript:ENSMGAT00000004625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLITIKEAHDIEARLNEVEKLLKTIINMPWKYSRSEVVLTFFERSPLDQVLKNDNVHKIQ
PSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNGKEKHLDVDSAEHLFESVSDFTSELE
DSDDPTAYVTNLTYYHLVPFETDILD
Download sequence
Identical sequences A0A094KX53 G1MYA5
ENSMGAP00000003915 ENSMGAP00000003915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]