SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003971 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003971
Domain Number 1 Region: 4-121,181-396
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.42e-66
Family beta-Lactamase/D-ala carboxypeptidase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003971   Gene: ENSMGAG00000004190   Transcript: ENSMGAT00000004681
Sequence length 454
Comment pep:novel chromosome:UMD2:12:3578199:3584521:-1 gene:ENSMGAG00000004190 transcript:ENSMGAT00000004681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRSRDLLRRIKDEAGIPGILVGVSVDGREVWSEGLGYADVENRVMCKPETIMRIASISKC
LTMMAVAKLWEEGKLDLDAPVQKYVPEFPEKVYEGEKVTITTRLLVSHLSGIRHYEKDIA
KVKEEKEKANRALKLTKSGQDKEQKEKDGKGIEKSDSDKPKKEHEGEVKSRNSKPGRRDK
EFEHEEYYLKEKFESVIESLKIFKNDPLFFKPGSQFLYSTYGFTLLSAVVERVSGQKFTD
YMLKMFRDLDMLSTVLDDNEAMIYNRARCYVYNKKGRLVNAPYVDNSYKWAGGGFLSSVG
DLLKFGNALLYSYQAGQFRNNNGKLLPGYLKPDTVAMMWTPVPKTEVSWDRDGKYAMAWA
VVEKKQQYGFCRRQRHYASHTGGAVGASSVLLILPEELDSDAEDTAEVAPPRGVIVSIIC
NMQSVSLNSTALKIAREFDKEKRAQYIDFKKRDE
Download sequence
Identical sequences G1MYF1
ENSMGAP00000003971 ENSMGAP00000003971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]