SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004026 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004026
Domain Number 1 Region: 29-520
Classification Level Classification E-value
Superfamily Sema domain 9.68e-182
Family Sema domain 0.0000000000328
Further Details:      
 
Domain Number 2 Region: 582-666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000105
Family I set domains 0.057
Further Details:      
 
Domain Number 3 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000698
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004026   Gene: ENSMGAG00000004057   Transcript: ENSMGAT00000004736
Sequence length 756
Comment pep:known chromosome:UMD2:14:3179063:3194793:1 gene:ENSMGAG00000004057 transcript:ENSMGAT00000004736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVATVLLWATLLTLGWRAAHGKDGVPPTPRVQLSFKELKATGTAHFFNFLLNSSDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWPASQQRIEECILSGKNSNGECGNFIR
LIQPWNRTHLYVCGTGAYNPICAFINRGRKAQDYIFYLEPDKLESGKGKCSYDPKVDTVS
ALINEELYAGVYIDFMGTDAAIFRTMGKQTAMRTDQYNSRWLNDPAFVRAQLIPDSSERN
DDKLYFFFREKSADAPLSPGVYSRIGRICLNDDGGHCCLVNKWSTFLKARLVCSVPGPDG
IETHFDELQDVFIQQTQDTKNPVIYAVFSASGSVFKGSAVCVYSMADIRMVFNGPFAHKE
GPNYQWMPYTGKMPYPRPGTCPGGTFTPSMKSTKDYPDEVINFMRSHPLMYHAVYPAHRQ
PLVVRTNVNYRFTTIAVDQVDAADGRYEVLFLGTDRGTVQKVIVLPRDDMETEELMLEEI
EVFKVPAPIKVMTISSKRQQLYVSSAVGVTHLALHRCDIYGEACADCCLARDPYCAWDGK
ACSRYSASSKRRSRRQDVRHGNPMRQCRGYNSNANKNTVEAVQYGVEGSTAFLECQPRSP
QATVKWLLQKDNSDRRKELRTEGGRALRTEQGLLLRALQLSDSGLYSCTATENNFKHTVT
KVQLRVLAARAVHAVLLQGELPPAALPGAPTPRYQDLLQLLTRPELGLLDQYCQGFWRPP
APGPPEPLAALKAKELQDQKKPRSRRNHPPESCGHT
Download sequence
Identical sequences G1MYJ4
XP_003210066.1.16129 ENSMGAP00000004026 ENSMGAP00000004026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]