SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004117 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004117
Domain Number 1 Region: 41-380
Classification Level Classification E-value
Superfamily Sema domain 8.89e-131
Family Sema domain 0.000000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004117   Gene: ENSMGAG00000004323   Transcript: ENSMGAT00000004830
Sequence length 444
Comment pep:novel chromosome:UMD2:14:3224586:3227751:1 gene:ENSMGAG00000004323 transcript:ENSMGAT00000004830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMGGGQGGQPGWLVAAATPAPSRGPIGDDEAELRARHGLRLFQLERSCCYEALLLDEER
GRLFVGAKNHLLSLSLDNISQRDRKIYWPAPVEWREECNWAGKDITAECMNFVKILHAYN
RTHLYACGTGAFHPTCAFVEVGQHTEDHIFKLDTRRAEDGKGKSPYDPRHAAASVLVGEE
LYSGVATDLMGRDFTIFRSMGSRPSVRTEQHDSRWLNEPKFVDVFWVPESENPDDDKIYF
FFREMAVERQQGLGKASISRIGQICRNDVGGQRSLVNKWTTFLKARLVCAVPGTDGADTH
FDELRDVFLLQTRDKRNPLVYAAFSTSSSIFQGSAVCIYTMADIRRAFLGPFAHKEGPNY
QWVPYQARVPYPRPGMAPAEPSAPSAPPRTSRMRCTTQCYPTASGPSSCKLACPTPSPAS
PSIVWLPPMATTTSSSLAQMWALC
Download sequence
Identical sequences G1MYR4
ENSMGAP00000004117 ENSMGAP00000004117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]