SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004268 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004268
Domain Number 1 Region: 179-274
Classification Level Classification E-value
Superfamily AMPKBI-like 1.57e-35
Family AMPKBI-like 0.00000551
Further Details:      
 
Domain Number 2 Region: 79-163
Classification Level Classification E-value
Superfamily E set domains 5.13e-28
Family AMPK-beta glycogen binding domain-like 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004268   Gene: ENSMGAG00000004460   Transcript: ENSMGAT00000004981
Sequence length 274
Comment pep:novel chromosome:UMD2:10:6688423:6694041:1 gene:ENSMGAG00000004460 transcript:ENSMGAT00000004981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTTSERVSGERHGSKSHRSDSSGAAHPAKEHPHKIMVGSTDDPSVFSSHDSKIPGDKE
FVSWQPDLEESVKPSQQARPTVIRWADGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDL
PEGEHQYKFFVDGQWVHDPSEPVVTSQMGTINNLIHVKKSDFEVFDALKVDSLESSETSG
RDLSSSPPGPYGQEMYVYRPEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVML
NHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences G1MZ37
ENSMGAP00000004268 ENSMGAP00000004268 XP_003208637.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]