SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004296 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004296
Domain Number 1 Region: 347-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.57e-56
Family Nucleotide and nucleoside kinases 0.0000207
Further Details:      
 
Domain Number 2 Region: 205-337
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-32
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 118-223
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000145
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 4 Region: 66-119
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000271
Family L27 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004296   Gene: ENSMGAG00000004450   Transcript: ENSMGAT00000005010
Sequence length 554
Comment pep:novel chromosome:UMD2:29:4805679:4810658:-1 gene:ENSMGAG00000004450 transcript:ENSMGAT00000005010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPITAHHQVSWAMQQVLDNLLGLPSAPGAADLDLIFLRGIMESPIVRSLAKAHERLEETK
LEAVRDNNLELVQEILHDIGHLVQQDSTAAELARILREPHFQSLLETHDSVASKSYETPP
PSPVLDPTFSNQPVPPDAVRMVGIRKTAGENLGVTFRVERGELVIARILHGGMVAQQGLL
HVGDVIREVNGQEVGSNPRVLQDSLRHASGSVVLKILPSYQEPHPPRQVFVKCHFDYDPA
SDSLIPCKEAGLRFSAGDLLQIVNQDDPNWWQACHVEGGSAGLIPSQLLEEKRKAFVKRD
LEVASTSAGALCSSLSGKRKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGA
QGVGRRSLKNKLIMSDQARYGTTIPYTSRKPKDSEKDGHGYHFVSRGEMEADIKAGHYLE
HGEYEGNLYGTKIDSIRAVVNAGKMCILDVNPQAVKVLRTAEFVPYVVFIEAPSAETLRA
MNRAALESGVAIKQLSEADARRTVEESSRIQHGYSHYFDLSLTNDNLEHTFGQLREAMEH
LRAEPQWVPVTWVY
Download sequence
Identical sequences G1MZ60
ENSMGAP00000004296 ENSMGAP00000004296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]