SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004314 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004314
Domain Number 1 Region: 631-941
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-88
Family Protein kinases, catalytic subunit 0.0000000713
Further Details:      
 
Domain Number 2 Region: 199-276
Classification Level Classification E-value
Superfamily HR1 repeat 6.28e-25
Family HR1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 117-188
Classification Level Classification E-value
Superfamily HR1 repeat 2.35e-23
Family HR1 repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 15-90
Classification Level Classification E-value
Superfamily HR1 repeat 2.35e-21
Family HR1 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 372-462
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000333
Family PLC-like (P variant) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004314   Gene: ENSMGAG00000004448   Transcript: ENSMGAT00000005028
Sequence length 961
Comment pep:novel chromosome:UMD2:19:5386556:5404190:1 gene:ENSMGAG00000004448 transcript:ENSMGAT00000005028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSPQGSCLLQLGNGVNLMDPSFQQKLEGEKELLRRAIQKELKIKEGAENLRKATTDR
KNLAHIEHVLKSSNRKLEQLHWELQELNARIVITDKEDSKTDGSLSPDPCLWERNPDPLA
RKVEALKKQLHVEMKVKQGAENMIQMYSSATSKERKLLATAKQMLQDSKTKIEIIRMHIV
KVSQSAGGMEDTVDPAATISAVELRIEELRHRLRIEAAVAEGAKNVLKILGGSRVQDRKF
LAEAQGRLQESSQKIDLLRLSLERQLSGLSPDHPKRALIKQELVNTSSLGAQHGIIQPTS
VIKPTALTGTLEVRLMGCQDLLENVPGRSRMAGSSPICGSPGDLKSFSLTRVGLGIHGRS
VAGKYLRNEELCNEVLAVLKVDNKVVGQTNWGPVNNQAWDQSFVIELDRSRELEISIYWR
DWRELCAVKFLRLDDFLDNERHGMCLLLEPQGMLFAEVMFCNPVIERKPKLQRQKRIFPK
QKGKEFLRAPQMNISVAAWGRLMMSFLPPCSSISTLSPPLHDSMHADFSPVPLQNHVNSI
TKAKLTYGDEAPPKPPRLFLMAKSKEPTPSPADSPSVAGEYVSCILERYTVAYIPKTKSY
FKFYFPSNILCSWLVVTVADEPAERKGAVHLEDFHCIAMLGRGHFGKVLLAQYKATGKLY
AIKALKKKDIIRRDEIDSLNCEKRIFEVVNSSDHPFLVNMFACFQTPHHACFVMEYTPGG
DLMMRIHEDVFPERTAQFYTACVVLGLQFLHEKKIVYRDLKLDNLLLDAEGFVKIADFGL
CKEGIGFGDRTNTFCGTPEFLAPEVLTDISYTRAVDWWGLGVLIYEMLVGESPFPGDDEE
EVFDSIVNDEVQYPRFLSSEALSIIRKLLRKCPERRLGAGEKDAEEVKIQPFFKEMDWDA
LYAKTLKPPFVPTLKDPTDISNFDEEFTSQKPILTPPEEVALLSRKEQAVFKDFDFVSKH
L
Download sequence
Identical sequences G1MZ76
ENSMGAP00000004314 ENSMGAP00000004314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]