SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004343 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004343
Domain Number 1 Region: 91-173
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000171
Family HtrA-like serine proteases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004343   Gene: ENSMGAG00000004522   Transcript: ENSMGAT00000005057
Sequence length 177
Comment pep:novel chromosome:UMD2:17:5901328:5904279:1 gene:ENSMGAG00000004522 transcript:ENSMGAT00000005057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCYQLLEDQKGVGMDGPLVDAEGFPRADIDLYQVRTARHIIACLQNDHKVLMKQVEEALH
QLHAREKEKHARDEAEAQAEAMSQSLPPAFAKVNAVTPESPASTSGLQVDDEIVEFGSVN
VHNFKSLQNIAAVVQHSEGRPLSVTVIRNGKKVHLGLTPKRWAGKGLLGCNIIPLQR
Download sequence
Identical sequences G1MZ97
ENSMGAP00000004343 ENSMGAP00000004343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]