SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004382 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004382
Domain Number 1 Region: 28-497
Classification Level Classification E-value
Superfamily Sema domain 3.92e-163
Family Sema domain 0.000000000707
Further Details:      
 
Domain Number 2 Region: 500-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000471
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 563-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000302
Family I set domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004382   Gene: ENSMGAG00000004513   Transcript: ENSMGAT00000005098
Sequence length 693
Comment pep:novel chromosome:UMD2:30:3048489:3056139:1 gene:ENSMGAG00000004513 transcript:ENSMGAT00000005098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASAVVLCLVLQLMQEVKASVGNCIPRKTVKYQTLNVEMFVKEGLSNVSALLVDEETDR
LFVGGRDVISALDLNNISRETAREHWFATQERQLECIRRGKDKIRCQNYILVLHKINDSH
VYVCGTNAYHPLCDHMVIQRTKMHLQGRAEESRGKCPFEPTLKYASVFVDGAFYSATSNN
FLGTEPIILRSMQNPVRTEFKTSWLNEPSFVGMEIVPESEFSPDGDDDKIYVFFTETAVE
FEFYDKILVSRIARICKGDLGGKRLLQRRWTSFLKARLSCSVPELNFHFNIIQDIFFLRR
RKWQDSIFYGIFSQQWGRLDTSAVCAYSMASIREAFSKGSYRGPITVEHSHVRWMVFRGE
VPVPRPGACIDNFARNLGYNTSSDLPDKVLQFARDHPLMDGSVNPIGERPALLKRSSNYT
RIVVDRVTGLDKQTYDVMFLGTDDGYLHKAFNCDGEMFIVEELQLFLSPEPVQFLQLSAK
KGMLYVGALSAVVQLPVSGCQRYKHCLDCILARDPYCAWSQAAQACVLLSDQSADTKNLI
QNVKYGDASSCLSVGIEIGILLNVEFHTGNNVHLKCVPLSNLARVVWKFNGSRIRDEDSK
YLLYDGGIAIFNATAAETGFYDCLSVEKSKAKEFFITVARYALYAQQSTDATKQKSVGSQ
KENLVLKLLCAGFALLFFFLFIWNFYKGHISLP
Download sequence
Identical sequences G1MZC4
ENSMGAP00000004382 ENSMGAP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]