SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004464 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004464
Domain Number 1 Region: 321-382,425-613
Classification Level Classification E-value
Superfamily VPS9 domain 4.45e-83
Family VPS9 domain 0.000000000796
Further Details:      
 
Domain Number 2 Region: 160-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family A20-like zinc finger 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004464   Gene: ENSMGAG00000004630   Transcript: ENSMGAT00000005181
Sequence length 719
Comment pep:novel chromosome:UMD2:21:5347346:5375752:1 gene:ENSMGAG00000004630 transcript:ENSMGAT00000005181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVVTGQSKGSGDPDEAMSSSDAEDDFQEPATPTATQAGQALPLLPQQCRITDLPVCCKG
TNGAAAKCSLQGSSVLFHRTIARPSRGCPASERRESEASFPGPNAILQSSRSLGGSLSCD
KPSLCAPDSGFMCRQNKQNRKKMSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKC
WREEYHKARQKQIQEDWELAERRVTLCCSEGFSSFIQAISTSTSASFLLTFSPPSFKPSF
SFRITMLQREEEEAYASSQSTQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFTASSRTGAK
KEIQEAKAPSPSINRQASIETDRVSKEFIEFLKTYHKPGQDIYKQCKLFLDTMNHKRDLS
IEEQSECAQDFYQNVAEKLQTRWKVNLTYHRGAFPAAKSGNTPSLSTQESWNTVFTVLGW
GVLYLAAPPEKVEKAMDQIEKYIMTRQYKYVFCPETTDDEKKDLAVQKRIRALHWVTPQM
LCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASA
DDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQ
SLNLSQEDFDRFMTGQTSPKKQESDSWSPDVCLGVKQMYKNLDLLSQLNERQDRIVSEAK
KLEKDLIDWTDGVAKEVQDIVEKYPLEIKPKNQALAAIDSENVENDKLPPPLQPQVYAG
Download sequence
Identical sequences G1MZJ5
ENSMGAP00000004464 ENSMGAP00000004464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]