SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004502 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004502
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily E set domains 2.73e-23
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004502   Gene: ENSMGAG00000004687   Transcript: ENSMGAT00000005220
Sequence length 124
Comment pep:novel chromosome:UMD2:Z:62949584:62950309:-1 gene:ENSMGAG00000004687 transcript:ENSMGAT00000005220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQSPQAGTKEKTLCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRVVVPKAAI
YQTQAFYAKGKMKEVKQLVANLRGESLSSGKTETWNGKVLKIPPVSPSILDCSIIRVEYS
LMVC
Download sequence
Identical sequences G1MZM1
ENSMGAP00000004502 ENSMGAP00000004502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]