SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004523 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004523
Domain Number 1 Region: 130-277
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-32
Family UAS domain 0.027
Further Details:      
 
Domain Number 2 Region: 316-444
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-20
Family UBX domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004523   Gene: ENSMGAG00000004672   Transcript: ENSMGAT00000005241
Sequence length 446
Comment pep:novel chromosome:UMD2:15:9980438:9988689:-1 gene:ENSMGAG00000004672 transcript:ENSMGAT00000005241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGWGEGRDLFRHREKVARKCSKDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPS
VFNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYFIMLPFRFTYYTLLDIFRFALR
FIRPDPRSRVTDPVGDIISFIHMFEEKYGRIHPVFYQGTYSQALNDAKRELRFLLVYLHG
DDHQDTDEFCRNTLCVPEVVALINTRMLFWACSTNKPEGYRVSQALRENTYPFLAVIMLK
DRRMTVVGRLEGLIQADDLINQLMFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLA
SLRADQEKERKKKEERERKKKKEEEVQQQKLAEERRRQTLQEEKERKSECLPPEPHPDDP
ESVKIIFKLPNDSRVERRFHFTQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCLPTEE
WPNPPTLQEAGLSHTEVLFVQDLTDD
Download sequence
Identical sequences G1MZN8
ENSMGAP00000004523 ENSMGAP00000004523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]