SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004603 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004603
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily PX domain 7.46e-25
Family PX domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000004603
Domain Number - Region: 150-236
Classification Level Classification E-value
Superfamily TPR-like 0.000262
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004603   Gene: ENSMGAG00000004775   Transcript: ENSMGAT00000005323
Sequence length 274
Comment pep:novel chromosome:UMD2:13:5975042:5978083:1 gene:ENSMGAG00000004775 transcript:ENSMGAT00000005323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSKASLRPNSSMTTKELQEYWRNEKSQCRQVKLLFEIPSTRIVEHHLSKYVMYKIIILQ
TGSFDSSKSVIERRYSDFEKLHRNLLEDFSEEMEDMTFPKKALTGNFTDEIINERKLAFK
DYLRLLYSMKYIRRSKKFIDFLTKPELQEAYGCLRGGQYNKALEILLEVIGLQERLTRGN
PAATVPTLCAIVVCHKDLGNAANAFEYGEKALSHLCMRNSHKYYVPLLEAMITLAYELGK
DFLSLQEKLEEWKAKKDPVRVFSLKELAVREYVK
Download sequence
Identical sequences G1MZU5
ENSMGAP00000004603 ENSMGAP00000004603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]