SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004738 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004738
Domain Number 1 Region: 127-367
Classification Level Classification E-value
Superfamily vWA-like 3.95e-72
Family Integrin A (or I) domain 0.00000121
Further Details:      
 
Domain Number 2 Region: 1131-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 3.08e-36
Family Fibronectin type III 0.0000095
Further Details:      
 
Domain Number 3 Region: 1526-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-34
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 628-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.01e-17
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 5 Region: 993-1114
Classification Level Classification E-value
Superfamily CalX-like 7.85e-16
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 6 Region: 25-76
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000045
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 551-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Integrin beta EGF-like domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004738   Gene: ENSMGAG00000004816   Transcript: ENSMGAT00000005459
Sequence length 1813
Comment pep:novel chromosome:UMD2:20:4725670:4745778:-1 gene:ENSMGAG00000004816 transcript:ENSMGAT00000005459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPCVGLLLLLALLCTTTLGQRSRNNRCVQSRAKSCTECIRVAKECSFCTEENFEEPRCD
LRENLLRYGCGEAGIVYTRGEMRTQQNISINTFLQRTQVAPQAMFMSLRAGEEMSFNMDV
FQPLESPVDLYILMDFSYSMSDDLDNLKSMGHNLAEFLQALTSNYTIGFGKFVDKVSSPQ
TDMRPEKLREPWNNADSPFSFKNVIRLTNNINYFSQELRKERISGNLDAPEGGFDAILQT
AVCEDKIGWRKDSTHLLVFSTESAFHYEADGTNVLAGILARNDEECHLDTHGTYVYDTKQ
DYPSVPTLVRLLGQHNIIPIFAVTNHSYSYYEKLHKYFPISEIGVLQEDSSNIVELLRTA
FERIRSKMDIRADFVPKALKTEFISSMYEKTESGSFHITRGEVGKFQVRVKALEHIGGQH
VCTLPEKDRQGIIHVKPTSLSDSLQVQASVVCDVCPCEQQPDFRSPKCSFHGDFICGQCI
CHAGWRGDTCDCSPASSLNNEACIRPGDVEPCSGRGECLCGKCQCYPEDLMQRFDGDFCQ
YDVLQCPRTSGFLCNDRGRCSKGACVCESGWEGPGCECPTSNDTCIDSRGGICNNQGRCE
CGRCICDKSSLYTSSTCEISYSLGFQAVCESIRDCVQCQAWGTGNRKGNCSTCHLHVQMV
EELKKAEEANEHCSFQDEEDDCTYHYTLEGDPSVLPNATVQVQKKKECPPGSFLWLIPLL
IFLILLLGLLLLLCWRYCACCKACLALLPCCARAGRTVGFKEDHYMLRQSLMSSDHLDTP
MVRSGSLKGRDTVRWKINNNVHKQGFTSHAALNPKDLIPYGLSLRLTRLFTQNLVKPESR
ECEQLRKEVEENLDDIYKHIPGCYKPQQTKFRVQPNSGKRQDHTIVDTVLTAPRSAKTEI
IKVTEKHVSHEAFNDLKVSPGYYTVTSDQDAHGMVEFQEAVELVDVRVPLFIREDDDDEK
QLQVEAIDVPTGIAQIGRRIVNITIIKEQASSLITFLQPAYSHSRFDKVAKIPVLREIID
NGRSQVTYRTRDLTAKEGRDYVFTEGDLVFQPGETRKEVQVSLLELTEIDTLLHNRQVKQ
FAIDLLHPKYGAKIGRYPQATVTIADPEVVDGVPPLTGMGQLTQSPKGRLSAPLNPSAQA
LSSKEIHFSWFPPTGKPLGYKVKYWVQGDPESEVNVMDIKSPGATLKNLYAFCDYEMQVC
AYNAMGEGAYSDIIQCRTLENVPSEPGRLAFNVVSSTVTQLSWAEPAETNGVITAYEVSY
GLVNDENVPIGPMKKVLVEDPKKRMVLIENLRESQPYRYMVKARNGAGWGPEREATINLA
TQPKRPMSIPIIPDVPIIDAEGGEDYDSYLMYSTDVLRTPAGSKRPSVSDDSAKGCGWKA
EPSRLEQTQTMPDLSWPAEDLPRTSTNGELQNDLPEQLKPGQSQGKAMGPGAEAHPQPGP
LHVPSFTEHLLNGRMDYFSGSSSTLTRTANTSYHQHVQQEHRVMGSSSLTRDYSTMMAGH
GLHHTTFPFAGDFSCVPSHDSRFPLGVPDIPTRLVFSALGPTSLKVSWQEPHCEKEVQGY
SVQYQLLNGGEVHRLTIPNPSQNSVVVENLLPNHSYIFKVKAQSEEGWGPEREGVITIES
QVDPQSPLSPVPGSPFTLSTPSAPGPLVFTALSPDSLQLSWERPRKPNGAILGYMITCEM
LHGGGEPRNIYVEGDNPETTLTVPHLSENIPYKFKVQAKTTQGVGPEREGIITIESQDGG
TEPRLSGNAEVLSHSLEDSSTQPLVADGMLMTSQRVESASSTLTKQVTKEFVSRTVTSSG
TLTKQVERQFYEA
Download sequence
Identical sequences G1N046
ENSMGAP00000004738 ENSMGAP00000004738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]