SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004799 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004799
Domain Number 1 Region: 408-516
Classification Level Classification E-value
Superfamily PDZ domain-like 5.19e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 17-108
Classification Level Classification E-value
Superfamily PDZ domain-like 5.46e-21
Family PDZ domain 0.0000921
Further Details:      
 
Domain Number 3 Region: 689-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000001
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 4 Region: 517-593
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000617
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004799   Gene: ENSMGAG00000004922   Transcript: ENSMGAT00000005521
Sequence length 1780
Comment pep:novel chromosome:UMD2:12:5621624:5662954:-1 gene:ENSMGAG00000004922 transcript:ENSMGAT00000005521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQLRETALQSATMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGLLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRMKKIQIPVARQE
PEPVSENEDDSYDEEIRDPRSSRGASSANRRHEKSWVRDRSASRERSLSPRSDRRSVTSS
QPAKPTKVTLVKSRKNEGNTHRILLLGPLPIFKGQLHQSVLCFTSSNTYELNQGVSISIY
TELLKTRNEYRHSWKRSCVAKTNKNYCKRLIFHLSRSCHHKNNFYLTDISEIQSLASDHS
NRSHDRPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSREDERVTKPGAVSTPVKNADD
ISKTMEEVAVERTEKQTPPLPEPKPVYAQGGQPDVDLPVSPSDGPLPNSTHEDGMLRPSM
KLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREE
AVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEV
FRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFW
RFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLA
REEPDIFQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDRDKHALLDVTPNAVDRLNYAQWY
PIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERAHKLRKNNHHLFTTTINLNSMNEGW
YGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSD
YEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHETQTYTSYASQA
QPQPNLRIDSSGFKTTASQPKAEASPAVPYLSPSPESNPATSSTSAVNANVNLTNVRLEE
PTAAPYNSYQPQAGPLRTSSTEGAHVVLRDQEPSSLPPHIDPAKVYRKDPYINEEASRQS
YLKQPAVNHPAQRQERDPNLIYESQSQYAEKQPSREYEQSTYRYDSTNYVDQFSRGYDPR
LHYEDRVPPYEEHWSYYDEKQPYSQPRTAYESQPPRDLDSRQNTEESTERSYYPAQPRFE
EHPPMSYDGRPRYEHAPKNFSLPQVRYEDQHPVGYDTHAHGRYKQEAQPYQSAISRSPEP
KQYFDPHMRGYEQGPPQAYNAKAGQFEPSHSTSSVSLPPPASSQTKPEVLPSNSKPLPTP
PSLAEEEEDPAMKPQSVRSRVKIFERRRSPSLEKMKDPSDTSAVKPPELAPKPTLPAMSG
PKTTSQSQYEHDKTTYRAPEPQRPQVKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRNFE
NKPSAQVPASHHSDSTKPIHSQNQLNFSNYSNRGKPTDAESMDRSVGDKRYEPIPQVTTP
PPAPSVQYTQPQSINSPVLSLPAHHKPALSEDGNSLGMSNSFNSVSDPPPPQNKPAIFRS
SREDTVQSTFYPQKSFPDKGPVNGTEQVQKTVTPSYNRFTTKPYTSAARPFERKFESPKF
NHNLLPNEAQHKPELPSKSPNSPQPILKAHSSSQPPEFDSGMDTFTVQVDKPKYQPNNVN
AVPKAIPVSPTALEDEEEEDGHTVVATARGVFNSNGGVLSSIETGVSIIIPQGAIPEGIE
QEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSF
ALKSSDSSSGDPKTWQNKSLPGDPNYLVGANCVSVLIDHF
Download sequence
Identical sequences G1N091
ENSMGAP00000004799 ENSMGAP00000004799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]