SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004890 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004890
Domain Number 1 Region: 144-461
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.11e-99
Family Transglutaminase core 0.0000000862
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily E set domains 3.5e-38
Family Transglutaminase N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 593-691
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.07e-25
Family Transglutaminase, two C-terminal domains 0.00085
Further Details:      
 
Domain Number 4 Region: 482-592
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.58e-24
Family Transglutaminase, two C-terminal domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004890   Gene: ENSMGAG00000004978   Transcript: ENSMGAT00000005613
Sequence length 693
Comment pep:novel chromosome:UMD2:22:7218636:7227543:1 gene:ENSMGAG00000004978 transcript:ENSMGAT00000005613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLSIKKCDLKIIMNNNNHHTEEISTERLIVRRGQPFIITVSFSSPIHNYLKQLKRTF
LSVQTGPQYSKADRTQVKFPVSSLGDQKQWSAKLEEQHPYFWTISVNTPANAPIGQYDLF
LHASKVYCLLGKFILLFNPWCRDDLVFLPNEAQRQEYILNQDGVIYWGTENEILAQPWDF
GQFDVGIVDICFRLLDIGEGYQQDKDQTQRKNPIYICRTVAAMMNCNLSRKILTESGTRE
CYDGTPPSKWLGSSSILQQWVTLQGQPVRYGQCWVFAAVMCSVLRCLGIPTRVVTGFTWA
HNTNSNPNVNEYYNEDGTLLTPDKSARVWTFHVWNECWMARTDLLPEYSGWQALDATCQK
KIEGPSFCGPAPVQAIKEGDVEVDYDVCYFFAAMNAKCKVWIHMADDILKPAFICTKYTG
NNISTKSVGSERCEDITHNYKYPEATGSLPEKKVLDKVYRKAISSRREIISVPPGLEERV
NLFIHLQSKSSLILGQDIPLSIEMFNYSGREKSTHLVLGVQSLHYNGVPIMQLWKEKFNF
IIRNNEVNTLQVFVPYSWYGKELGENRLLRLTATVRDEDSYIYFAQEEISICDPPLTIEF
PENVVLYQPSTVKISLLNPLTEPLEKCVIVVGGRGLIYRQRKYRLGSVQPNSTQDLHISF
TPTEAGTRRLTVHLTCLQIQNLKSYKSITVAAA
Download sequence
Identical sequences G1N0F3
ENSMGAP00000004890 ENSMGAP00000004890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]