SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005229 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005229
Domain Number 1 Region: 29-525
Classification Level Classification E-value
Superfamily Sema domain 2.09e-184
Family Sema domain 0.000000000014
Further Details:      
 
Domain Number 2 Region: 521-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000173
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 589-671
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000353
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005229   Gene: ENSMGAG00000005266   Transcript: ENSMGAT00000005961
Sequence length 761
Comment pep:novel chromosome:UMD2:1:6513824:6612047:-1 gene:ENSMGAG00000005266 transcript:ENSMGAT00000005961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASQVPNACSLLSLAMLLLPVTGTSKQNIPRLKLSYKDLLLSNSCIPFLGSTEGLDFRT
LLLDEERGRLLVGAKDHIFLLNLVDLNKNVKKIYWPAAKEKLELCKLAGKDAHTECANFI
RVLQPYNRTHVYVCGTGAFHPLCGYIELGTHKEETIFRLDTQNLESGRLKCPFDPQQPFA
SVMADEYLYAGTASDFLGKDTALTRSLGPSHDHHYIRTDISEHYWLTGAKFIATFPIPDT
YNPDDDKIYFFFREISQDSSTSDKTILSRVGRVCKNDMGGQRSLINKWTTFLKARLVCSI
PGPEGADTHFDELQDIFLLSTRDERNPLVYGVFTTTSSVFKGSAVCVYSMADIRAVFNGP
YAHKESADHRWVQYEGRIPYPRPGTCPSKTYDPLIKSTRDFPDEVISFIKRHPLMYKSVY
PLTGGPVFTRINVDYRLTQIVVDHVMAEDGQYDVIFLGTDIGTVLKAVSITKEKWSKEEV
VLEELQIFKHPSFISTMEISQKQQQLYIGSRDGLVQLSLHRCHTYGKACADCCLARDPYC
AWDGNSCSRYAPTSKRRARRQDVKYGDPVTQCWDVEDSISHETADEKVIFGIEFNSTFLE
CIPKSQQASIRWYIQRTGEEHREELKADERIIKTEHGLLIRSLQRRDAGAYFCKAQEHTF
IHTIVKLNLNVIENGQMESTQKTEDEEGRVRDLLTESRLRYKDYIQLVSSPSFSLDEYCE
QMWHREKRRQRNKGGAKWKHVQEMKKKRNRRHHEPARPPST
Download sequence
Identical sequences G1N178
XP_010713446.1.16129 XP_010713513.1.16129 ENSMGAP00000005229 ENSMGAP00000005229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]