SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005371 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005371
Domain Number 1 Region: 4-371
Classification Level Classification E-value
Superfamily Sema domain 1.44e-133
Family Sema domain 0.000000000951
Further Details:      
 
Domain Number 2 Region: 367-421
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000192
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005371   Gene: ENSMGAG00000005350   Transcript: ENSMGAT00000006104
Sequence length 624
Comment pep:novel chromosome:UMD2:1:9474686:9509048:-1 gene:ENSMGAG00000005350 transcript:ENSMGAT00000006104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDHLFQLESHKFERGRGRCPFDPTSSFTSILIGGELFTGLYSDYWGRDAAVFRTMNRMAH
LRTEPDSERLLKEPKFVGSYMIPDNEDHDDNKVYFFFTEKALEAETSTHAIYTRVGRVCV
NDMGGQRMLVNKWSTFLKTRLVCSVPGRNGIDTHFDELEDVFLLQTRDNKNPVIFGLFST
TSNIFRGYAICVYHMASVRAAFNGPYAHKEGPEYHWALYEGKVPYPRPGSCASKVNGGLY
TTTKDYPDEAVHFARSHPLMYQPIKPVHKRPILVKTDGKYNLKQIAVDRVEAEDGQYDVL
FIGTDNGIVLKVITIYNQETESMEEVILEELQVFKVPIPIISMEISSKRQQLYIGTESVI
AQVKFHQCDMYGTACADCCLARDPYCAWDGISCSRYYPTGMQAKRRFRRQDVRHGNAAQQ
CFGQQFIGEVLEKTEERLVYGIEYNSTLLECTPRTLQAKVIWFVQRAHETKKEEVKTDDR
IIKMDLGLLFLKLHRLDAGTYFCQTVEHSIVHTVRKITLEIVEEERVDEMFNKDYEEEIS
HKMPCPVQSNIPQVSKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKY
ANPQEKKARIRPEHYRLPRNIADS
Download sequence
Identical sequences G1N1I1
ENSMGAP00000005371 ENSMGAP00000005371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]