SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005471 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005471
Domain Number 1 Region: 14-128
Classification Level Classification E-value
Superfamily PX domain 1.83e-32
Family PX domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005471   Gene: ENSMGAG00000005549   Transcript: ENSMGAT00000006204
Sequence length 165
Comment pep:novel scaffold:UMD2:GL425398.1:1557:4354:-1 gene:ENSMGAG00000005549 transcript:ENSMGAT00000006204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSGSRMLESREEELTTVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYR
EFVWLRRQLQKNAGLVPVPELPGKSTFFVGSTDEFIEKRRQGLQQFLEKVVQNVVLLSDS
RLHLFLQSQLSVPEIEACVQGQGSQTVTEAILHYAMSNCGWVQEE
Download sequence
Identical sequences H9H0V2
ENSMGAP00000005471 ENSMGAP00000005471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]