SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005689 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005689
Domain Number 1 Region: 33-519
Classification Level Classification E-value
Superfamily Sema domain 2.22e-179
Family Sema domain 0.0000000000762
Further Details:      
 
Domain Number 2 Region: 515-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000349
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 580-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000804
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005689   Gene: ENSMGAG00000005705   Transcript: ENSMGAT00000006431
Sequence length 752
Comment pep:novel chromosome:UMD2:1:11015577:11065868:1 gene:ENSMGAG00000005705 transcript:ENSMGAT00000006431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKGFSSFVGLRKCCSFEVIMATEHTCKLPIFTISELQGTKTSEYHRISHSPLDYRILL
MDEDQDRIYVGSKDHILSLNINNISQDPLSIWWPASANKVEECKMAGKDPTHGCGNFVRV
IQSYNRTHLYVCGSGAFSPVCVYVNRGRRSEEQIFKIDSKCESGKGRCSFNPNVNTVSVM
INEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPIFVDAHVIPDGTDPNDA
KIYFFFKERLTDNSGSTKQIHSMIARICPNDTGGQRSLVNKWTTFLKARLVCSVMDEDGT
ETYFDELEDVFLLETDNPRTTLVYGIFTTSSSIFKGSAVCVYHLSDIQTVFNGPFAHKEG
PNHQLIPYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNPIYPIHKRP
LIIRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDQGTVQKVVVLPTNFSASGELILEELE
VFQSNTPITTMKISSKKQQLYVSSEEGITQVPLHRCHIYGTACACCLARDPYCAWDGNSC
SRFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAETVQYGVKNNTTFLECTPKSPQA
SIKWLLQKDNDRRKEVKLNERIIATEQGLLIRSVQDSDRGLYHCIATENNFKQTLAKINF
KVLDTEMVAYMTDKWSPWTWASSVRALQFHPKDFVGTFSHSEMQMINQYCKDSRQQGQRR
EEPQKLRGDYSKLKALINSRKSRNRRNQLPGS
Download sequence
Identical sequences G1N265
ENSMGAP00000005689 ENSMGAP00000005689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]