SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005785 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005785
Domain Number 1 Region: 73-166
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-27
Family PDZ domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005785   Gene: ENSMGAG00000005833   Transcript: ENSMGAT00000006528
Sequence length 271
Comment pep:novel chromosome:UMD2:16:6535123:6555889:1 gene:ENSMGAG00000005833 transcript:ENSMGAT00000006528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVQRIKAVETETRLLVVDKETDEYLCSLRLTCTEEMAHISVAESRGDSRTHPWFPCPGQ
AILGSSGADAGAEDLNGQKELCPRLCHLKKGPNGYGFNLHSEKSRPGQFIRSVDPDSPAS
RAGLRPQDRLVEVNGINVEGLRHSEVVSHIKARESEARLLVVDPETDEYFKKLGVTPTEE
HTKGVVPQPMTNGSAQMQLNGGSTSSSHSDLQSPGKESEDGDSEKRDPFEESGLSLSPTA
AEAKEKVRAKRVKKRAPQMDWNKKREIFSNF
Download sequence
Identical sequences G1N2D5
ENSMGAP00000005785 ENSMGAP00000005785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]