SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005809 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005809
Domain Number 1 Region: 2724-2984
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-70
Family Protein kinases, catalytic subunit 0.0000023
Further Details:      
 
Domain Number 2 Region: 1907-2103
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-54
Family DBL homology domain (DH-domain) 0.0000129
Further Details:      
 
Domain Number 3 Region: 1242-1420
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-51
Family DBL homology domain (DH-domain) 0.00000000826
Further Details:      
 
Domain Number 4 Region: 2105-2227
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-34
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 
Domain Number 5 Region: 1427-1547
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-33
Family Pleckstrin-homology domain (PH domain) 0.000000769
Further Details:      
 
Domain Number 6 Region: 2615-2711
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 258-394
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1056-1193
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 805-959
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-20
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 10 Region: 479-620
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2480-2545
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000609
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1593-1684
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000194
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 14-168
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 625-732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000109
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 172-288
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000314
Family Spectrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005809   Gene: ENSMGAG00000005861   Transcript: ENSMGAT00000006553
Sequence length 3030
Comment pep:novel chromosome:UMD2:3:25149997:25324408:-1 gene:ENSMGAG00000005861 transcript:ENSMGAT00000006553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGFRKNDEMKAMEVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYL
ACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTN
FGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHML
SRLEELQDILSKKEMPQDLEGARNMIEEHSQLKKKVIKAPIEDLDVEGQKLLQRIQSSDS
FPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEK
MFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVES
GHYASQQIKQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEQYMSNVDSWCKACGEV
ELPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYS
KAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLS
KHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQ
LEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIK
RFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQM
EELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHH
ADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQE
LDVAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHE
QFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRECAEKVASHWQQLMLKMEDRLKLLV
NASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAF
LKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMR
KRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAK
QTKERVKLLIQLADGFCEKGHAHATEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISS
DSNKSSKSLQLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRD
LRECMDTYLWEMTSGVEEIPPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVG
HCFVTWADKFQMYVTYCKNKPDSTQLILEHAGAYFDEIQQRHGLANSISSYLIKPVQRIT
KYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQE
SFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYIYKSKLFTSELGVTEHVEG
DPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKT
APTTKQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTAC
NSNELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGI
FNHKDSLSVSSNDASPPASVTSLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKAD
GHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETIEERGRNEGLSSGTLSKSSSS
GMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKTSSRLLVRPTSSETPSAAELV
SAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRR
HYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFF
LGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHR
LQLTDLLIKPVQRIMKYQLLLKDFLKYSKKANLDTTELERAVEVMCIVPKRCNDMMNVGR
LQGFDGKIVAQGKLLLQDTFLVTDQDAGLLPRCKERRVFLFEQIVIFSEPLDKKKGFSMP
GFLFKNSIKVSCLSLEENVDSDPCKFALTSRTGDATETFVLHSASPGVRQLWIHEINQIL
ENQRNFLNGHCCPTLQWQQHSGSAGDHDDILCDTGSCNGQTNTLRIWSRISFCPSWLLTN
STTWXEADKMSGMSIHNLSLPHYNTSLETGLSQPDRHPPSAEPDGPQREAEQIPKMKVIE
SPRKTAGNISGSADGAQKDSRGSSEESRSRNSIGSLTLGKPRPGAISPMNSPLSTTFPSP
FGKETFPPSSPLQKGSFWSSIPASPASRPGSFTFPGDNDSLQRQVHRHSSHSKDTDRMST
CSSTSEQSVHSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNM
FLVFRAATDQCPAAEGWIPGYVLGHTSAVIMDNPDGTIKKSTSWHTALRLRKKSEKKDKD
GKREGKLENGYRKSREGLANKVSVKLLNPNYIYDVPPEFIIPLSEVTCETGETIVLRCKV
CGRPKASVTWKGPDHNTLSNDGHHSISYSDLGEASLKIIGVTAEDDGIYTCIAANDMGSV
SSSASLRVLGPGSDGIMVIWKDNFDSLYSEVAELGRGRFSVVKKCDQKGTKRRAVATKFV
NKKLMKRDQVTHELGVMQNLQHPQLIGLIDTFETATNYILVLEMADQGRLLDYVVRWGNL
TEGKIRLYLGEILEAVQYLHNCRIAHLDLKPENILVDQSSSKPTIKLADFGDAVQLNTTY
YIHQLLGNPEFAAPEIILGNPVSLTSDVWSIGVLTYVLLSGVSPFLDESVEETCLNICRL
DFSFPDDYFKGVSQKAKDFVCFLLQDDPAKRPSAALTLQEQWLQLGNSKGTDSIDISRLT
SFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences G1N2F4
ENSMGAP00000005809 ENSMGAP00000005809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]