SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005849 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005849
Domain Number 1 Region: 821-1215
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-100
Family Ras GEF 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005849   Gene: ENSMGAG00000005844   Transcript: ENSMGAT00000006593
Sequence length 1227
Comment pep:novel chromosome:UMD2:19:6380954:6453609:-1 gene:ENSMGAG00000005844 transcript:ENSMGAT00000006593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDPCPDSERSHLSSFTMKLKGKFHSPKIKRTPSKKGKQADLTVKTPEKSANKEATDSFP
GRLLVPAVFEDGEAAAELGTSQVSKIFPLLQNVSWLEEKEKEVVSALRYFKTIVDKMAID
KKVLEMLPGSASKVLEAILPLVQTDPRIQQSSAISSCYSRVYQSLANLIRWSDQVMLEGV
NSEDKEMVTTVKDVIKAVLDGVKELVKLTIEKQEHPSPTSPVKPSLPACKSDSPSELPLT
DREMEILSKTTNMTQSNELLTDSMDEEVAPPKPPLPCIRVAENSPPPALPPKKRQSAPSP
TRVAVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYGGESPRLSPCSSIGKL
SKSDEQLSSLDRDSGQCSRNTSCETLDQSDHYDPDYEFLQQDLSNADQIPQQVPGILSPL
PESLGESGSPFHGHAFQLPQGSSSPLEFCSVSGAVQPTETPPALPEKKRRSAASQTSDSG
CRVSYERHPSQYDNISEDDMQNAGSLSSVPCTPFAPILPFQQGNSSAPVEFIADFAAPDS
NSDPEKPPPLPEKKNKHMMAYMQFVEDYSEPQPSMFYQTPQNEHIYQQKNKHLMEVYGFN
DSFISLDPSQDLAPPPALPPKQRQLQASYAASSFPSISYCVQQTKVPFTPEDTGAAQGLT
MSVSNSFLNRHSSFPVHSYKSVFRSYSQDFVPHNQVSVAPFLSSTSSSCSTAPFPPVHPS
PSSDLAVPATASPSPSTGDVPNSSSQESSFNGSAPVCLPSETSLTDSLQTPSESPSVKDG
HSKDSTSNSSAMGKEGKDGAERQQQSPDALESSQLEEEVDELSLIDHSEIMARLTLKQEG
DDGPDVRGGSGDILLVHATETDRKDLVLYCEAFLTTYRTFITPEELIKKLQYRYPFPYTF
KKRVSKNTFFVLVRVVDELCLVELTEEILKLLMDLVFRLVCNGELSLARVLRKNILDKVD
QKKMLRYANSIKPLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKE
QNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYL
AILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALADVEPPCIPYLGLILQ
DLTFVHLGNPDYIDSKVNFSKRWQQFNILDSMRCFQQVHYDIKRNDDIVSFFNDFSDHLA
EEALWELSLKIKPRNITRRKTDREEKT
Download sequence
Identical sequences G1N2I3
ENSMGAP00000005849 ENSMGAP00000005849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]