SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005862 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005862
Domain Number 1 Region: 632-739
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-25
Family PDZ domain 0.0029
Further Details:      
 
Domain Number 2 Region: 274-370
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-22
Family PDZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 510-611
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 377-475
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-18
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 43-116
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-16
Family RING finger domain, C3HC4 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005862   Gene: ENSMGAG00000005892   Transcript: ENSMGAT00000006606
Sequence length 743
Comment pep:novel chromosome:UMD2:9:12042462:12058219:-1 gene:ENSMGAG00000005892 transcript:ENSMGAT00000006606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHFLATMADPTAEEQAHHGAELCCECGQFHLLPDNHLYNFQNEVDDELICHICLQPLLQP
MDTPCGHTYCFKCLENFMQEYNFCPMDRKKLSLQQCHKSSLLVRNLLDKLVVVCPFKAEC
QQTMQRCELEAHLKNRCPGFKKYKCELQRKRNPVSKGKEEPLSKVETSTPRDPEVPRDPE
VPSGGSTLLAESSAAAVVSLGTAEPGLVNPAFEETEEDKSNHLHCSLEPLVSIPARRKCV
SVSRCAETGGEMEEEEERKLEEGSCSELPVRASPVAETSTIEIHREDPEEELGMRIVGGK
DTPLGNIVVQEVLRDSIIAADGRIAPGDHILEVNGVNISSVTHCQAVSFLRHPGPVLHLI
VLQEKGFSNKTTQQDSTSATNQEVIHVTLVKRDRSEPLGIKLIRKTDEAGIFILDLLEGG
LAAKNGKLSRNDRVLSINGQDLRQGTPETAAQIIQSEGEPVLFLLISKGPDRQLVEFLTG
SNLRQNVWRHSSVTQNIFTRTKYKKVTLPSSSIAKCSELEQRYVSHEKTVAIKKEPKESL
GITIGGGRDNKNKLPIYVTSVQPIGCLFRDGRIKRGDVLLSINGIDLTHLNYYEAVSALK
SNAASHSVILKALEILLTDTTDPSLDIKERGFSWSPLWITWLGLPSYLHCCQDIVLSKGN
QESWGFSIVGGFEESKGNQPFFIKTIVPGTPACRNARLKCGDEIVAVNGVPAVGMSNSEL
IPMLKEQKNKVTLTVVSWPGSLV
Download sequence
Identical sequences G1N2J3
ENSMGAP00000005862 ENSMGAP00000005862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]