SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005911 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005911
Domain Number 1 Region: 954-1060
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-27
Family PDZ domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 235-341
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-25
Family PDZ domain 0.00000454
Further Details:      
 
Domain Number 3 Region: 730-833
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-23
Family PDZ domain 0.00000971
Further Details:      
 
Domain Number 4 Region: 591-687
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-22
Family PDZ domain 0.0000193
Further Details:      
 
Domain Number 5 Region: 410-513
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-18
Family PDZ domain 0.0000148
Further Details:      
 
Domain Number 6 Region: 123-160
Classification Level Classification E-value
Superfamily WW domain 0.000000000000415
Family WW domain 0.0011
Further Details:      
 
Domain Number 7 Region: 170-205
Classification Level Classification E-value
Superfamily WW domain 0.00000000209
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005911   Gene: ENSMGAG00000005938   Transcript: ENSMGAT00000006656
Sequence length 1290
Comment pep:novel chromosome:UMD2:1:12052156:12298174:1 gene:ENSMGAG00000005938 transcript:ENSMGAT00000006656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPDNYYGTPKPPAEPAPLLVNVTDQILPGATPGAEGKRKRNKSVSNMEKTGIEPPEEEEE
ERPVVNGNDVTVTPESSEHEDKSTGVSGEVSSTQPCPAPGYTQPEEAKEDMDVTKQTKPE
ENDDLGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEK
IDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPNAELGTKPMQAQGFREKPLFTRD
ASQLKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYI
NEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAVMERPPVV
VNGRHNYETYLEYISRTSQSVPDVTDRPPHSLHSIPADSQLDSTFPPPAHDDNVSMASSG
ATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNL
SHAEVVDILKECPVGSETSLIIHRGGFFSPWKTPKPVMERWENQGSPQTSLSAPALPQNI
PYPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVLPRTGFRVDSSGPDYKEL
DVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKT
HRYVIDLMHNAARNGQVNLTVRRKVLPTGEPCPENGRSPGSVSTHHSSPRSDYATYANSN
HAVSSSNATPPEGFTSHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRI
IDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPAS
APSSEKQSPLAQQHSPLSPLAQQQSPITQHSPVAQPTLPQPLQLQGHENSYRSEVKARQD
VKPDIRQPPFTDYRQSSTDYRQPPLDYRHPPVMDYQQPPPLDYRQPPLLDYRQHSPDTRQ
YPLSDYRQPQDFDYFTVDLEKGAKGFGFSIRGGREYKMDLFVLRLAEDGPAIRNGRMRVG
DQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYVATTDEPSSWSAPAAA
SPGLPEVALSLDDIISPLSSSHIAPPSDPSHQISPEPTWDIKREHDGRKPKELSVNGHKK
KRLGEQRERSASPKKADRSKHDEPSWKGYSEGKTKVTDGGRLSSESRAVGHSIMMEAGAR
EHVKREDHRSTNASEKKSAAAPDHAKLDAGATKTYSSNRCSSPGSDMDHSQRDPDGKPIR
KATVSPGPWKIPGSDKLPGVLKSGTSAMSR
Download sequence
Identical sequences G1N2N4
ENSMGAP00000005911 ENSMGAP00000005911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]