SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006115 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006115
Domain Number 1 Region: 272-600
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-81
Family p120GAP domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 557-693
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-40
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 5-103
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.25e-18
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006115   Gene: ENSMGAG00000006040   Transcript: ENSMGAT00000006862
Sequence length 800
Comment pep:novel chromosome:UMD2:11:9971338:10007791:1 gene:ENSMGAG00000006040 transcript:ENSMGAT00000006862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLVPNKMRDFFCTINLDQEEVFRTQVVEKSLSPYFGEEFYFEIPRTFQWLSFYIYDKSVL
QKDLRIGKVAIKKEDLCNYTGKENWFTLQPVDSNSEVQVTIKLHAYLFKITITQKTLMQG
MLCNLDSCPEIIFILHACTSFFNSFALSFPSQNRDYTNNTGNKKISLNFSKIHIAQLVNS
STDICKPKKEIEKREDVRKETCTVKNCLVINTQQNEKCGHSVQVPVGVYKDGWFRCVCYY
LLQPRENGNKSSKTDDLGSLRLNICYTEDCVFPSEYYAPLRNLLLKSSDIQPISASAAYI
LCEVCRDKYDAVLPLVRLLLHHHKLVPFVAAVAELDLKDTQEANTIFRGNSLATRCVDEM
MKIVGKHYLKVTLKPVIDEICESPKPCEIDPIKLREGDNVETNMENLRYYVDKVFREIVR
SSISCPTLMCDVFYSLRHLAAKRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHH
PDAQTSRTLTLISKAIQTLGSWGSLTKSKLSSFKETFMCEFFKTFQEEKFTESVKKFLDD
VSSTESKEPSGLSEPIHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSREFTYHKQQDKEP
IFTIPIKNILAVEKLDESSFNKKNMFQVLHGEKPLYIQANNCVEASEWIEALCRVTRCNQ
KRLSFYHPSAFLNGNWLCCKATVENTVGCARCTADVPADTQIEIDGDRETERIYSLFTIN
MSKLQKLEEACGSIAVYQGPRKEPDDYSNFTIEDSVATFHTLKQIIDTVEKLNESHEKYQ
KKRSSSAEYGSEKNPIGKVS
Download sequence
Identical sequences G1N350
ENSMGAP00000006115 ENSMGAP00000006115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]