SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006193 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006193
Domain Number 1 Region: 10-413
Classification Level Classification E-value
Superfamily Sema domain 4.97e-107
Family Sema domain 0.00000165
Further Details:      
 
Domain Number 2 Region: 708-764
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.89e-16
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 521-571
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000314
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 576-627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 465-518
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000837
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006193   Gene: ENSMGAG00000006186   Transcript: ENSMGAT00000006940
Sequence length 775
Comment pep:novel chromosome:UMD2:3:27855039:27971071:1 gene:ENSMGAG00000006186 transcript:ENSMGAT00000006940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFPAFLTNFCWLQAVEWQCDEATKRACYSKGKSKEECQNYIRVLLVGGNHLFTCGTNAFT
PICTNRTMSMIKQISFQISGEKKCIYSSRTNGNLFLQVQQEIKALKVEDQPKHNTLILRD
LRELALLTNSAQNSNLFSEPNFVSSYDIGNFTYFFFRENAVEHDCGKTVFSRAARVCKND
IGGKFVLEDTWTTFMKARLNCSRPGEIPFYYNELQSTFFLPELDLIYGIFTTNVNSIAAS
AVCVFNLSAITQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQ
KFFLMHEVVQPVIPIPYFMEDNSRFSHVVVDVVQGKDMLFHIIYLATDYGTIKKVLAPMN
QTSSSCLLEEIELLPKSQREPIRSLQILHSQSVLFVGLQEHVIKVPLKRCLFYKTFRSAE
LFAGDNICSKNFAAPCNSSEEESIESGKWLKAIPPCTSETRNLTVDGHFGTWSQWKPCSH
TDGASIGSCLCRTRVCDSPAPQCGGWLCEGPTMEIANCSRNGGWTPWTSWSPCSTTCGIG
FQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGWGPWERCTAQCGGGIQ
ARRRTCENGPDCPGCSVEYQPCNTNACPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCK
ARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRSGRYSAHTINGAWSPWSAWS
QCSRDCSRGIRNRKRVCSNPEPKYGGLPCLGPSLEYQECNILPCPGNSLWECWNS
Download sequence
Identical sequences G1N3B5
ENSMGAP00000006193 ENSMGAP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]