SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006272 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006272
Domain Number 1 Region: 465-577
Classification Level Classification E-value
Superfamily PH domain-like 5.24e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 12-94
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000024
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 255-295
Classification Level Classification E-value
Superfamily WW domain 0.0000000367
Family WW domain 0.0026
Further Details:      
 
Domain Number 4 Region: 360-389
Classification Level Classification E-value
Superfamily WW domain 0.0000209
Family WW domain 0.003
Further Details:      
 
Domain Number 5 Region: 652-685
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000366
Family BCR-homology GTPase activation domain (BH-domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006272   Gene: ENSMGAG00000006267   Transcript: ENSMGAT00000007019
Sequence length 685
Comment pep:novel chromosome:UMD2:6:14333806:14388971:1 gene:ENSMGAG00000006267 transcript:ENSMGAT00000007019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEMADRSAKILPGQLYIEVEYDYEYEAKDKKIVIKQGEKYILVKKTNDDWWQVKKDENSK
PFYVPAQYVKEIPRKALMPPVKQAGMLPNNALKLTHGLQRSTENVNKSPELSSFGKSSPV
QVSCLVRDANQNLGPNNSPGQTLGLSLDLTQNNGKLNNELQSPKVSNQFRTISMGHFPCP
EFLEIEKTSFLHEQSCDSAGEGSEKIHQDSESGDELSSSSTEQAQPTTPPSQGRPDSPVY
ANLQELKISQSALPPLPTSAPVQINGEWETHKDTTGRCYYYNRGSQERTWKPPRWARDAS
INKGDSQSHADHEHLSSEENDHSSCYSQSDSQYGSPPKGWSEELDEHGQTLYTNDYTNEK
WLKHADEQGRPYYYSADGSRSEWELPKYNASPQQQRDIIKSRSLDRRLQEPIVLTKWRHS
TIVLDTNDKESSSSSKASFPENESSPSSPKHQATVSFSSPQGQEKYGLLNVTKITENGKK
VRKNWMSSWAVLQGSSLLFTKTQGSGTGWFGVNQSKPEFTVDLKGALIDWASKDKSSKKN
VIELKTRQGTELLIQSDNDSFINEWYKVLNYTINNQVVESDEALEDEVPDSPGVEKQDKE
KENKDSKKLRSVKIPSNIDATDQKKTKTKLKKFLTRRPTLQAVREKGYIKDQVFGSNLTS
LCQRENSTVPKFVKLCIEHVEEHGM
Download sequence
Identical sequences G1N3H7
ENSMGAP00000006272 ENSMGAP00000006272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]