SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006296 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006296
Domain Number 1 Region: 52-201,236-258,289-441,469-582
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-118
Family Ras GEF 0.00013
Further Details:      
 
Domain Number 2 Region: 677-771
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-40
Family Ras-binding domain, RBD 0.00000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006296   Gene: ENSMGAG00000006234   Transcript: ENSMGAT00000007043
Sequence length 802
Comment pep:novel chromosome:UMD2:19:6968208:6974421:-1 gene:ENSMGAG00000006234 transcript:ENSMGAT00000007043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGVSCPMQSSTQEIGEELEDGVIYSISVRKVQLHHTANKGQRWLGFENESALNLYETCKV
RTIKAGTLEKLVEYLVSAFKGNDSTYVTIFLCTYRAFATTKQVLDLLLNRYGKLHVQTNG
DHARHVVDERMELKNTISSILGAWLDQYSEDFRKPPDFACLKQLISYVRHNIPGSDLERR
ARILLAQFQQQEQSEAEAEGGGGSLLVGMSGSVGSFRCHHVAGEEVYWEAYPAKLESAFN
PLQTLAPRLNMPINLSEPYLELCAIFTAVDHGGCTFQLVDENGVGDGKSDFLSFSPEMVA
EQFTLMDAELFKKVVPYHCLGCIWSQRDKKGKEHLAPTIRATVSQFNSVANCVIATCLGD
RTLKPQQRAKVVERWIEVARECRILKNFSSLRAILSALQCNAVHRLKKTWDEVLRESFRT
FHELSEIFSDENNHSLSRELLIKEGTSKFATLEINPKRAQKRQQQQREMGVMQGTIPYLG
TFLTDLVMLDTAMKDFLDGGLINFEKRRKEFEVIAQIKLLQSACNNYSFTQEDHFVDWFH
SLERLSEAESYGMSCEIEPLSESASNTLKAKKNTGIIKRWSDRQPASTEPCASGSSHSKS
FDQLKCGQXNISFIPESPDCQEKKFWESTSLSSLDTSGIGSGSSSASSSSVSSTPVTASR
THKRSVSGISSYSSLSLPLYNQQVDDCCIIRVSLAVDNGNMYKSILVTSQDKTPVVIRKA
MAKHNLDGDRPEDYELVQIISEERELKIPDNANVFYAMNSAANYDFVLKKRGFSKGVKIK
HGSSSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences G1N3J7
ENSMGAP00000006296 ENSMGAP00000006296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]