SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006328 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000006328
Domain Number - Region: 14-181
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0565
Family BAR domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006328   Gene: ENSMGAG00000006330   Transcript: ENSMGAT00000007076
Sequence length 210
Comment pep:novel scaffold:UMD2:GL425652.1:879:1827:1 gene:ENSMGAG00000006330 transcript:ENSMGAT00000007076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTRLPLCSPPRFSRRSILEQHQRELRYLRDVAVAVEQNHAREEHEATLNFQSARDEIKNK
SLQEKQYSRLQLSGKLEGLWEQFQHAVRCYAEATEHRKLSFEALKVKDEKSSREVEVQEK
KLQKLQDAVLAAKARLAAHLHECEEQNQRMRERKEAAMEQLQQLKSEMSRAQAKAHRSLA
ELTAQSGAALKALGKIVGKAERVLRLAELC
Download sequence
Identical sequences H9H0Z1
ENSMGAP00000006328 ENSMGAP00000006328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]