SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006375 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006375
Domain Number 1 Region: 102-410
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.8e-118
Family Glutaminase 0.00000434
Further Details:      
 
Domain Number 2 Region: 435-515
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000249
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006375   Gene: ENSMGAG00000006345   Transcript: ENSMGAT00000007125
Sequence length 569
Comment pep:novel chromosome:UMD2:7:7811662:7914150:1 gene:ENSMGAG00000006345 transcript:ENSMGAT00000007125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGGGGEGKMKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDM
LRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQ
SGGKVADYIPQLAKFSPDLWGVSLCTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDLG
TEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGANNAEKFDYVMQF
MNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVAILDFYFQLCSIE
VTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAK
SGVAGGILLVVPNVMGLMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLD
PRREGGDQRVKSVINLLFAAYTGDVSALRRFALSGMDMEQRDYDSRTALHVAAAEGHVDV
VKFLLEACKVNPFPKDRWNNTPMDEALHLDTTMCLKFSRSIRSNTHRRRIPIMARRTERF
IKTWMAYYNRSQLDPKNPISYLFNCGILK
Download sequence
Identical sequences G1N3Q4
ENSMGAP00000006375 ENSMGAP00000006375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]