SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006404 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006404
Domain Number 1 Region: 204-512
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.39e-89
Family Protein kinases, catalytic subunit 0.0000000203
Further Details:      
 
Domain Number 2 Region: 26-148
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.7e-36
Family Synaptotagmin-like (S variant) 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006404   Gene: ENSMGAG00000006453   Transcript: ENSMGAT00000007156
Sequence length 542
Comment pep:novel chromosome:UMD2:16:6997767:7031445:1 gene:ENSMGAG00000006453 transcript:ENSMGAT00000007156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CMMNVHKRCVMNVPXLCGTDHTERRGRIYIRADIEKDVLTVVVRDAKNLVPMDPNGLSDP
YVKLKLIPDPKNESKQKTKTIKCSLNPEWNETFRFQLKEADKDRRLSVEIWDWDLTSRND
FMGSLSFGISELQKSGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGTGS
KAADEKMTNAISKFDNNGSRDRMKLSDFNFLMVLGKGSFGKVMLAERKGTDELYAVKILK
KDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQ
VGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWD
GVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIM
EHNVAYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIKEHAFFRYIDWDKLERKEIQ
PPFKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFFNSEFFKPEAKRA
AV
Download sequence
Identical sequences G1N3S9
ENSMGAP00000006404 ENSMGAP00000006404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]