SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006408 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006408
Domain Number 1 Region: 583-608
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000222
Family Ran binding protein zinc finger-like 0.00044
Further Details:      
 
Domain Number 2 Region: 6-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000241
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006408   Gene: ENSMGAG00000006376   Transcript: ENSMGAT00000007160
Sequence length 609
Comment pep:novel chromosome:UMD2:20:5825932:5851229:-1 gene:ENSMGAG00000006376 transcript:ENSMGAT00000007160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSPQIIRVQSPEGVKRITATKRETVATFLKKVAKEFGFRNNGFSVYTNRNRTGEITASQ
NKSLNLLKIKHGDMLFLYPSSPAGSSSETMDTSVSQSLRPVGAPQVVEDDIDQYLIKQDG
KIYRNRDQQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGK
FVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLD
FWRKTGNQHLGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLEILEDPKAEVVDEI
AAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYYLSAEECITAGNFQNQHPNICRLSP
DGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQ
YVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENHDVL
GETQDFHSLATYLSQNTSSVFLDIVSDFHLLLFLVTNEVMPLRDSISLLLEAVRTKNEEL
AQTWKKSEQWATIEQLCSTVGVQLPGLHEYGAVGGSTHAVSAAMWACQHCTFMNQPGTDH
CEMCSLPRT
Download sequence
Identical sequences G1N3T3
ENSMGAP00000006408 ENSMGAP00000006408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]