SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006421 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006421
Domain Number 1 Region: 16-336
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.76e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006421   Gene: ENSMGAG00000006422   Transcript: ENSMGAT00000007173
Sequence length 337
Comment pep:novel chromosome:UMD2:23:6114246:6122303:-1 gene:ENSMGAG00000006422 transcript:ENSMGAT00000007173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPRYPEPVPLDHPIPILKEALEKVDLMLRQKIHNSGLPAMSAIVIYNDTVLWTGNFGKK
NASDPFSVVPNEYTIYRIASVSKIFPTLMLYKMWEEGKVTSLDDPLERYAQNFAIKNPLG
RFRESEQSVTLRRMASQLSGLPRRLRSTSLLWKGNTQEALALLKDDVLVADPGTRCHYSN
LAFSLMAHVLADHAADGQYQRWISENILDRLGMEDTGFDITPPIRSQMAVGFYSSQQPAP
LYDLGWYRPSGQMYSTAADLAKLAMVFLGTYHRRLLEPDTVKTMLTPLFKCSTEYFANKT
GTPWEINEQLGYDVIRKDGDLDGYSATFSLVPAWQIG
Download sequence
Identical sequences G1N3U5
ENSMGAP00000006421 ENSMGAP00000006421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]