SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006504 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006504
Domain Number 1 Region: 6-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.01e-113
Family Calpain large subunit, catalytic domain (domain II) 0.000000124
Further Details:      
 
Domain Number 2 Region: 354-499
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.05e-36
Family Calpain large subunit, middle domain (domain III) 0.00023
Further Details:      
 
Domain Number 3 Region: 522-620
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.56e-18
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006504   Gene: ENSMGAG00000006471   Transcript: ENSMGAT00000007257
Sequence length 644
Comment pep:novel chromosome:UMD2:9:13217454:13261305:1 gene:ENSMGAG00000006471 transcript:ENSMGAT00000007257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVQLFRDQKYHELKRQCIQQRRLFKDPEFPASDESLFYQKAPRGKVEWKRPKDLCQD
PYLFVNGISSHDLNQGSLGNCWFVAACSCLALRKTLWQQVIPDFQEQEWDPKTPEKYAGI
FRFRFWCFGIWTEVVIDDLLPTIDGTLIYCHSNVENEFWSALLEKAYAKLAGSYEALDGG
SAADAIVDFTGAVAESIDLVQGKYSETISEQMKLFEDLLKVHKRGGLISCFIASSSGRAN
EVEAKTGLVAGHAYSVTAIRKLHLGESLTFSFNTEKLFMVRLRNPWGNREWNGAWSDNSE
EWKKVSNSERKRLGLTVENDGEFWMTFEDWCKNFTDVDICRIVNTSYFSIHKTWETKMMH
GAWEKNSDPLLNRSGGCFDNIETFLQNPQYIFDVKKTEDKVLISLQQEDRRRSKKVGKGD
NIIIGFEIFKVEGNRSYRLHKLTVQERVATSPYINTRNVFLKKILKQGRYILIPTTYLPG
ITTKFMLRLFTDVPSKLRELMADKPEMTCWSLLCGYPCRITQIKIHSAEGLQEQDGSSGA
DPYVLIKCENQKVRSPVQHNTTSAIFNTQVIFYRKNIDSPIIVQVWNSNILCDQFLGQAL
LAASPSDPREQQTLQLRGRGSQEAQEVPGHITVKVFSSDDLVEL
Download sequence
Identical sequences G1N408
ENSMGAP00000006504 XP_003208491.1.16129 XP_010713671.1.16129 XP_010713672.1.16129 XP_010713674.1.16129 XP_019473820.1.16129 XP_019473821.1.16129 XP_019473822.1.16129 XP_019473823.1.16129 ENSMGAP00000006504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]