SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006527 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006527
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Sema domain 7.32e-40
Family Sema domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 132-173
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000615
Family Plexin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006527   Gene: ENSMGAG00000006515   Transcript: ENSMGAT00000007280
Sequence length 178
Comment pep:novel scaffold:UMD2:GL425804.1:254:1020:-1 gene:ENSMGAG00000006515 transcript:ENSMGAT00000007280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CITDWHRQNGFPSSLALPDNTLNFAKKHPLMDEPVLPQRGRPLLLKKDSNFTQLVVDRVA
GLDGAVYEVLFVGTGDGWVHKALNLGSHVHLVEELQVFEPAQPVESLVLAGRKKLLFAGS
RLQVAQLPVADCGRYQSCADCVLARDPYCAWSRNGSRCVRSDGLNGSHLVQDVLGSDT
Download sequence
Identical sequences H9H108
ENSMGAP00000006527 ENSMGAP00000006527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]