SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006653 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006653
Domain Number 1 Region: 4-465
Classification Level Classification E-value
Superfamily Sema domain 1.7e-113
Family Sema domain 0.0000000000482
Further Details:      
 
Domain Number 2 Region: 467-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000144
Family Plexin repeat 0.00059
Further Details:      
 
Domain Number 3 Region: 529-600
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000189
Family I set domains 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006653   Gene: ENSMGAG00000006614   Transcript: ENSMGAT00000007408
Sequence length 753
Comment pep:novel chromosome:UMD2:Z:46115227:46137601:-1 gene:ENSMGAG00000006614 transcript:ENSMGAT00000007408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVQLIHFHEPGVSNYSTLLLSEDRGVLYVGAREVIFALNAVNIAEKQHEVTTSVKPGEES
NQNASRRAKEEEEPVLNSPSDLILDSIEKHTCSDLPLTAHLNLILFELEGKNEDGKGRCP
FDPAQSYTSVMVDEELYSGTSYNFLGSEPIISRNSHQSPLRTEYAIPWLNEPSSIYLSVL
QILHKGDNCPQDKAIWCIFFLSGIANVRHAFVFYKDTFFFSQCQKRDQGGLRTLQKKWTS
FLKARLICTIPDKNLIFNIINDVFILKSPTLKEPVIYGVFTPQLNNVGLSAVCAYNLSTV
EEVFSKGKYMQSATVEQSHTKWVRYNGEIPKPRPGAVRSEETRKANKQKKCNKNKKALLK
DHPLMDDSVTPMGDRPRLVKRDVKYTQIVVDRVRALNGTIYDVMFISTDQGALHKAISYE
NGMHIIEETQLFPNFEPVQTLILSSKKSRRYLYAGSNSGVVQSPVAFCEMYTTCFDCVLA
RDPYCAWKPLEGSCVDIFQESETERNWIQNIGGDASSCSDKVRENSLQHTFKHGSTAELK
CSQKSNLAQVVWKFRDDVLRVESPKYRLLEKALLIFNLSEGDSGVYQCLSEEKVKNKKFS
QVLAKHVLELKKVQQTTTSPVVAAAPIEGNSDVPKVSAVSTEGSTAQTSTTQIVPVTTAR
IITKPIGPVLTSATSNIELFNSLPDAVPEKTMFLKSNDNFLLMFLFLFFFILFLCLLSYN
CYKGYLPGQCLKFRSXFILRKKTAKKERAAVHQ
Download sequence
Identical sequences G1N4B3
ENSMGAP00000006653 ENSMGAP00000006653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]