SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006663 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006663
Domain Number 1 Region: 365-571
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-58
Family Nucleotide and nucleoside kinases 0.000097
Further Details:      
 
Domain Number 2 Region: 204-350
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-30
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 129-220
Classification Level Classification E-value
Superfamily PDZ domain-like 1.29e-20
Family PDZ domain 0.00084
Further Details:      
 
Domain Number 4 Region: 71-122
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000667
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006663   Gene: ENSMGAG00000006609   Transcript: ENSMGAT00000007418
Sequence length 576
Comment pep:novel chromosome:UMD2:6:15574182:15655860:1 gene:ENSMGAG00000006609 transcript:ENSMGAT00000007418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSEPAGEVCHKGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYY
EKQNPVPILHSAAALADDLAEELQSKPLNSEIRELLKLLSKPNLKALLSVHDTVAQKNYD
PVLPPMPDDIDEEEDSVKIIRLVKNREPLGATIKRDEHTGAIVVARIMRGGAADRSGLIH
VGDELREVNGIPVDDKKPEEIIHILAQSQGAITFKIIPSVKEETPSKEGKMFIRALFDYD
PNEDKAIPCKEAGLAFRKGDILQIMSQDDATWWQAKHEGDANPRAGLIPSKHFQERRFAL
RRPEVQIQPLKISNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADIPTYEEVAKY
RRQPNDKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQESDGVEYIFI
SKHLFETDVQNNKFIEYGEYKNNYYGTSLDSVRSVLAKNKVCLLDVQPHTVKHLRTYEFK
PFVIFIKPPPLDRLRETRKNAKIISSKDDRGTAKPFTEEDFQEMIKSAQLMESQYGHLFD
KVIINDDLATAYSELKATFDRLETETFWVPVSWLHS
Download sequence
Identical sequences G1N4C1
ENSMGAP00000006663 ENSMGAP00000006663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]